PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03949g07018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Whirly
Protein Properties Length: 143aa    MW: 16165.3 Da    PI: 6.5243
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03949g07018.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly155.81.4e-48110535139
                    Whirly  35 llelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgn 119
                               +l++ ++++erkydWek+q falsatev++l++++++++ceffhdp++ +sn+G+vrk+l+ +P +dGsG+fv+lsv n+ +k+n
  Niben101Scf03949g07018.1   1 MLTFWPSVGERKYDWEKRQLFALSATEVGSLISIGTRDTCEFFHDPSMLSSNAGQVRKSLSFKPNADGSGYFVSLSVVNNNLKTN 85 
                               89*********************************************************************************** PP

                    Whirly 120 esfsvPvskaefavlrsllv 139
                               ++f+vPv+ aefav+r++++
  Niben101Scf03949g07018.1  86 DRFTVPVTTAEFAVMRTAFS 105
                               *****************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF544473.14E-461136IPR009044ssDNA-binding transcriptional regulator
Gene3DG3DSA:2.30.31.102.7E-531124IPR009044ssDNA-binding transcriptional regulator
PfamPF085365.7E-451102IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MLTFWPSVGE RKYDWEKRQL FALSATEVGS LISIGTRDTC EFFHDPSMLS SNAGQVRKSL  60
SFKPNADGSG YFVSLSVVNN NLKTNDRFTV PVTTAEFAVM RTAFSFALPH IMGWDRFINQ  120
PLESISQSSS KVVPQLMETE WDR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A3e-84112350172StWhy2
3n1i_A3e-84112350172protein StWhy2
3n1j_A3e-84112350172Protein StWhy2
3n1k_A3e-84112350172protein StWhy2
3n1l_A3e-84112350172protein StWhy2
3r9y_A3e-84112350172Why2 protein
3r9z_A3e-84112350172Why2 protein
3ra0_A3e-84112350172Why2 protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598359.11e-100PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X4
RefseqXP_016508347.11e-100PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X5
SwissprotD9J0345e-97WHY2_SOLTU; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLK4D8E02e-95K4D8E0_SOLLC; Uncharacterized protein
STRINGSolyc11g044750.1.14e-95(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97822228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.17e-70WHIRLY 2